RHEB Rabbit Polyclonal Antibody

CAT#: TA342253

Rabbit polyclonal Anti-RHEB Antibody

Product Images

WB Suggested Anti-RHEB Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RHEB antibody: synthetic peptide directed towards the middle region of human RHEB. Synthetic peptide located within the following region: VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: Ras homolog enriched in brain
• Database Link:
  NP_005605
  Entrez Gene 6009 Human
  UniProt ID Q15382
• Background: This gene is a member ofThe small GTPase superfamily and encodes a lipid-anchored, cell membrane protein with five repeats ofThe RAS-related GTP-binding region.This protein is vital in regulation of growth and cell cycle progression due to its role inThe insulin/TOR/S6K signaling pathway.The protein has GTPase activity and shuttles between a GDP-bound form and a GTP-bound form, and farnesylation ofThe protein is required forThis activity. Three pseudogenes have been mapped, two on chromosome 10 and one on chromosome 22. [provided by RefSeq, Jul 2008]
• Synonyms: RHEB2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Zebrafish: 93%

Reference Data

• Protein Pathways: Insulin signaling pathway, mTOR signaling pathway