Eomes Rabbit Polyclonal Antibody

CAT#: TA342257

Rabbit Polyclonal Anti-Eomes Antibody

Product Images

WB Suggested Anti-Eomes Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Muscle

• 

  Immunohistochemistry with Placenta tissue at an antibody concentration of Dilution: 1:200 using anti-Eomes antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Eomes antibody: synthetic peptide directed towards the C terminal of human Eomes. Synthetic peptide located within the following region: SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: eomesodermin
• Database Link:
  NP_034266
  Entrez Gene 8320 HumanEntrez Gene 13813 Mouse
  UniProt ID O54839
• Background: Eomes functions as a transcriptional activator playing a crucial role during development. Eomes functions in trophoblast differentiation and later in gastrulation, regulating both mesoderm delamination and endoderm specification.Eomes plays a role in brain development being required for the specification and the proliferation of the intermediate progenitor cells and their progeny in the cerebral cortex. Eomes also involved in the differentiation of CD8+ T-cells during immune response regulating the expression of lytic effector genes.
• Synonyms: eomesodermin; TBR2
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 87%; Dog: 80%; Pig: 80%; Bovine: 80%; Guinea pig: 80%