HOXA1 Rabbit Polyclonal Antibody

CAT#: TA342265

Rabbit Polyclonal Anti-Hoxa1 Antibody

Product Images

Host: Rabbit; Target Name: Hoxa1; Sample Tissue: Rat Small Intestine lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Hoxa1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Hoxa1. Synthetic peptide located within the following region: KYLTRARSEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPMSPATPPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: homeobox A1
• Database Link:
  NP_005513
  Entrez Gene 103690132 Rat
  UniProt ID P49639
• Background: sequence specific transcription factor, may regulate positional development along the anterior-posterior axis, may be important for the maintenance and/or development of hindbrain segments [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: U93092.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS070542, SRS369732 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: BSAS; HOX1; HOX1F
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors