HOXA1 Rabbit Polyclonal Antibody

CAT#: TA342266

Rabbit Polyclonal Anti-Hoxa1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "HOXA1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Hoxa1 antibody: synthetic peptide directed towards the c terminal of mouse Hoxa1. Synthetic peptide located within the following region: ETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name homeobox A1
Background The function of this protein remains unknown.
Synonyms BSAS; HOX1; HOX1F
Note Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Human: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.