HOXA1 Rabbit Polyclonal Antibody

CAT#: TA342266

Rabbit Polyclonal Anti-Hoxa1 Antibody

Product Images

WB Suggested Anti-Hoxa1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Hoxa1 antibody: synthetic peptide directed towards the c terminal of mouse Hoxa1. Synthetic peptide located within the following region: ETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: homeobox A1
• Database Link:
  NP_005513
  Entrez Gene 15394 Mouse
  UniProt ID P49639
• Background: The function of this protein remains unknown.
• Synonyms: BSAS; HOX1; HOX1F
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Human: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors