Zbtb7a Rabbit Polyclonal Antibody

CAT#: TA342277

Rabbit Polyclonal Anti-ZBTB7A Antibody

Product Images

WB Suggested Anti-ZBTB7A Antibody Titration: 5.0 ug/ml; ELISA Titer: 1:1562500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB7A antibody: synthetic peptide directed towards the N terminal of mouse ZBTB7A. Synthetic peptide located within the following region: LEIPAVSHVCADLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: zinc finger and BTB domain containing 7a
• Database Link:
  NP_034861
  Entrez Gene 16969 Mouse
  UniProt ID O88939
• Background: The function of Anti-ZBTB7A has not yet been determined.
• Synonyms: DKFZp547O146; FBI-1; FBI1; LRF; MGC99631; pokemon; TIP21; ZBTB7; ZNF857A
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%