Nrf2 (NFE2L2) Rabbit Polyclonal Antibody

CAT#: TA342284

Rabbit Polyclonal Anti-Nfe2l2 Antibody

Product Images

Host: Rabbit; Target Name: Nfe2l2; Sample Tissue: Rat Thymus lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Nfe2l2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Nfe2l2. Synthetic peptide located within the following region: DLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQEQLQKEQE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: nuclear factor, erythroid 2 like 2
• Database Link:
  NP_006155
  Entrez Gene 83619 RatEntrez Gene 4780 Human
  UniProt ID Q16236
• Background: a basic leucine zipper transcription factor; involved in activating expression of genes with an antioxidant response element (ARE) [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF037350.1, CK483814.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS160522, ERS160537 [ECO:0000350] ##Evidence-Data-END##
• Synonyms: NRF2
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Rabbit: 92%; Human: 86%; Bovine: 86%; Yeast: 83%; Dog: 79%

Reference Data

• Protein Families: Transcription Factors