SAM68 (KHDRBS1) Rabbit Polyclonal Antibody

CAT#: TA342288

Rabbit Polyclonal Anti-KHDRBS1 Antibody

Product Images

WB Suggested Anti-KHDRBS1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KHDRBS1 antibody: synthetic peptide directed towards the N terminal of mouse KHDRBS1. Synthetic peptide located within the following region: MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: KH RNA binding domain containing, signal transduction associated 1
• Database Link:
  NP_006550
  Entrez Gene 20218 Mouse
  UniProt ID Q07666
• Background: Khdrbs1 functions as a transcriptional repressor and may link cellular signaling pathways with components of the transcriptional machinery. It shuttles between the nucleus and the cytoplasm in secondary spermatocytes, suggesting that it may promote translation of specific RNA targets during the meiotic divisions.
• Synonyms: p62; p68; Sam68
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Mouse: 100%; Pig: 92%; Bovine: 92%; Human: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors