SAM68 (KHDRBS1) Rabbit Polyclonal Antibody
Other products for "KHDRBS1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KHDRBS1 antibody: synthetic peptide directed towards the N terminal of mouse KHDRBS1. Synthetic peptide located within the following region: MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 49 kDa |
Gene Name | KH RNA binding domain containing, signal transduction associated 1 |
Database Link | |
Background | Khdrbs1 functions as a transcriptional repressor and may link cellular signaling pathways with components of the transcriptional machinery. It shuttles between the nucleus and the cytoplasm in secondary spermatocytes, suggesting that it may promote translation of specific RNA targets during the meiotic divisions. |
Synonyms | p62; p68; Sam68 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Mouse: 100%; Pig: 92%; Bovine: 92%; Human: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.