Spi1 Rabbit Polyclonal Antibody

CAT#: TA342289

Rabbit Polyclonal Anti-Sfpi1 Antibody

Product Images

Host: Rabbit; Target Name: Sfpi1; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Sfpi1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Sfpi1. Synthetic peptide located within the following region: MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: spleen focus forming virus (SFFV) proviral integration oncogene
• Database Link:
  NP_035485
  Entrez Gene 20375 Mouse
  UniProt ID P17433
• Background: Sfpi1 binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. It also binds RNA and may modulate pre-mRNA splicing.
• Synonyms: OF; PU.1; SFPI1; SPI-1; SPI-A
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 79%