Spi1 Rabbit Polyclonal Antibody
Other products for "Spi1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Sfpi1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Sfpi1. Synthetic peptide located within the following region: MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 31 kDa |
Gene Name | spleen focus forming virus (SFFV) proviral integration oncogene |
Database Link | |
Background | Sfpi1 binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. It also binds RNA and may modulate pre-mRNA splicing. |
Synonyms | OF; PU.1; SFPI1; SPI-1; SPI-A |
Note | Immunogen Sequence Homology: Mouse: 100%; Rat: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.