SOX7 Rabbit Polyclonal Antibody

CAT#: TA342291

Rabbit Polyclonal Anti-SOX7 Antibody

Product Images

WB Suggested Anti-SOX7 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:12500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the N terminal of mouse SOX7. Synthetic peptide located within the following region: LGAYPWTEGLECPALEAELSDGLSPPAVPRPSGDKSSESRIRRPMNAFMV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: SRY-box 7
• Database Link:
  NP_113627
  Entrez Gene 20680 Mouse
  UniProt ID Q9BT81
• Background: SOX7 belongs to the SOX family of transcription factors bind PS4A and differentially modulate transcription. It is a potent activator of Fgf-3 transcription.
• Synonyms: MGC10895
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Human: 86%; Pig: 79%; Bovine: 79%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors