Srebf1 Rabbit Polyclonal Antibody

CAT#: TA342292

Rabbit Polyclonal Anti-SREBF1 Antibody

Product Images

WB Suggested Anti-SREBF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: SP2/0 cell lysate

• 

  WB Suggested Anti-SREBF1 Antibody ; Positive Control: Lane 1: 50ug mouse glomerular endothelial lysate Lane 2: 50ug mouse glomerular endothelial lysate; Primary Antibody Dilution : 1:1000; Secondary Antibody : Anti-rabbit-HRP; Secondry Antibody Dilution :

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the N terminal of mouse SREBF1. Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 125 kDa
• Gene Name: sterol regulatory element binding transcription factor 1
• Database Link:
  NP_035610
  Entrez Gene 20787 Mouse
  UniProt ID Q9WTN3
• Background: Srebf1 is transcriptional activator that binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Srebf1 also binds to an E-box motif (5'-ATCACGTGA-3'). Srebf1 regulates the transcription of genes for sterol biosynthesis and the LDL receptor gene.
• Synonyms: bHLHd1; SREBP-1; SREBP-1c; SREBP1
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%