Tpbg Rabbit Polyclonal Antibody

CAT#: TA342297

Rabbit Polyclonal Anti-Tpbg Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Tpbg"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Tpbg antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tpbg. Synthetic peptide located within the following region: GDGRLRLARLALVLLGWVSASAPSSSVPSSSTSPAAFLASGSAQPPPAER
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 46 kDa
Gene Name trophoblast glycoprotein
Background May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a-dependent LRP6 internalization.
Synonyms 5T4; 5T4-AG; 5T4AG; M6P1
Note Immunogen Sequence Homology: Rat: 100%; Mouse: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.