MTA2 Rabbit Polyclonal Antibody

CAT#: TA342299

Rabbit Polyclonal Anti-MTA2 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MTA2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MTA2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARGTTEPHSRGHLSRP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 73 kDa
Gene Name metastasis associated 1 family member 2
Background May be involved in the regulation of gene expression as repressor and activator. The repression might be related to covalent modification of histone proteins.
Synonyms MTA1L1; PID
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Human: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.