MTA2 Rabbit Polyclonal Antibody

CAT#: TA342300

Rabbit Polyclonal Anti-Mta2 Antibody

Product Images

WB Suggested Anti-Mta2 Antibody Titration: 0.725 ug/ml; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Mta2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: metastasis associated 1 family member 2
• Database Link:
  NP_004730
  Entrez Gene 23942 Mouse
  UniProt ID O94776
• Background: May be involved in the regulation of gene expression as repressor and activator. The repression might be related to covalent modification of histone proteins.
• Synonyms: MTA1L1; PID
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Goat: 93%; Human: 93%; Guinea pig: 93%; Yeast: 90%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors