ECSIT Rabbit Polyclonal Antibody

CAT#: TA342303

Rabbit Polyclonal Anti-Ecsit Antibody

Product Images

WB Suggested Anti-SITPEC Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SITPEC antibody: synthetic peptide directed towards the middle region of mouse SITPEC. Synthetic peptide located within the following region: KVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: ECSIT signalling integrator
• Database Link:
  NP_001135937
  Entrez Gene 26940 Mouse
  UniProt ID Q9BQ95
• Background: Sitpec functions as an essential component in two important signal transduction pathways and establishes a novel role for Ecsit as a cofactor for Smad proteins in the bone morphogenetic protein signaling pathway.
• Synonyms: SITPEC
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 79%

Reference Data

• Protein Pathways: MAPK signaling pathway