ARA9 (AIP) Rabbit Polyclonal Antibody

CAT#: TA342316

Rabbit Polyclonal Anti-Aip Antibody

Product Images

WB Suggested Anti-Aip Antibody Titration: 0.2-1 ug/ml; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Aip antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VAKSLRNIAEGKDPLEGQRHCCGIAQMHEHSSLGHADLDALQQNPQPLIF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: aryl hydrocarbon receptor interacting protein
• Database Link:
  NP_003968
  Entrez Gene 11632 Mouse
  UniProt ID O00170
• Background: This gene encodes an Hsp90-associated protein that is localized to the cytoplasm. The encoded protein interacts with the aryl hydrocarbon receptor (AhR) and the tyrosine kinase receptor RET, inhibits AhR ubiquitination, and regulates the intracellular localization of AhR. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]
• Synonyms: ARA9; FKBP16; FKBP37; SMTPHN; XAP-2; XAP2
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors