Mybbp1a Rabbit Polyclonal Antibody

CAT#: TA342319

Rabbit Polyclonal Anti-MYBBP1A Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Mybbp1a"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MYBBP1A antibody: synthetic peptide directed towards the C terminal of mouse MYBBP1A. Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 148 kDa
Gene Name MYB binding protein (P160) 1a
Background Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
Synonyms FLJ37886; P160; PAP2
Note Immunogen Sequence Homology: Mouse: 100%; Rat: 92%; Pig: 83%; Guinea pig: 83%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.