MYBBP1A Rabbit Polyclonal Antibody

CAT#: TA342320

Rabbit Polyclonal Anti-Mybbp1a Antibody

Product Images

WB Suggested Anti-Mybbp1a Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Mouse Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Mybbp1a antibody: synthetic peptide directed towards the middle region of mouse Mybbp1a. Synthetic peptide located within the following region: EKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 152 kDa
• Gene Name: MYB binding protein 1a
• Database Link:
  NP_055335
  Entrez Gene 18432 Mouse
  UniProt ID Q9BQG0
• Background: Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
• Synonyms: P160; PAP2
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Human: 86%; Bovine: 79%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors