Atoh7 Rabbit Polyclonal Antibody

CAT#: TA342322

Rabbit Polyclonal Anti-Atoh7 Antibody

Product Images

WB Suggested Anti-Atoh7 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Atoh7 antibody: synthetic peptide directed towards the C terminal of mouse Atoh7. Synthetic peptide located within the following region: IALTRILAEAERDWVGLRCEQRGRDHPYLPFPGARLQVDPEPYGQRLFGF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: atonal bHLH transcription factor 7
• Database Link:
  NP_058560
  Entrez Gene 53404 Mouse
  UniProt ID Q9Z2E5
• Background: Atoh7 is a transcription factor involved in the differentiation of most retinal ganglion cells, including those constituting the retino-hypothalamic tract.
• Synonyms: bHLHa13; Math5
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 86%