RUNX3 Rabbit Polyclonal Antibody

CAT#: TA342336

Rabbit Polyclonal Anti-RUNX3 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RUNX3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RUNX3 antibody: synthetic peptide directed towards the C terminal of mouse RUNX3. Synthetic peptide located within the following region: PYPGAPQSQSGPFQANPAPYHLFYGASSGSYQFSMAAAGGGERSPTRMLT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name runt related transcription factor 3
Background RUNX3 belongs to The RUNX family of transcription factors that are important regulators of linage-specific gene expression in major developmental pathways. Runx3 is highly expressed in developing cranial and dorsal root ganglia (DRGs).
Synonyms AML2; CBFA3; PEBP2aC
Note Immunogen Sequence Homology: Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Human: 79%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.