GIMAP5 Rabbit Polyclonal Antibody

CAT#: TA342373

Rabbit Polyclonal Anti-GIMAP5 Antibody

Product Images

WB Suggested Anti-GIMAP5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GIMAP5 antibody: synthetic peptide directed towards the middle region of human GIMAP5. Synthetic peptide located within the following region: CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: GTPase, IMAP family member 5
• Database Link:
  NP_060854
  Entrez Gene 55340 Human
  UniProt ID Q96F15
• Background: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene encodes an antiapoptotic protein that functions in T-cell survival. Polymorphisms in this gene are associated with systemic lupus erythematosus. Read-through transcription exists between this gene and the neighboring upstream GIMAP1 (GTPase, IMAP family member 1) gene. [provided by RefSeq, Dec 2010]
• Synonyms: HIMAP3; IAN-5; IAN4; IAN4L1; IAN5; IMAP3; IROD
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 92%; Horse: 92%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane