SMC3 Rabbit Polyclonal Antibody

CAT#: TA342433

Rabbit Polyclonal Anti-SMC3 Antibody

Product Images

WB Suggested Anti-SMC3 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate.There is BioGPS gene expression data showing that SMC3 is expressed in HepG2

• 

  Testis

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMC3 antibody: synthetic peptide directed towards the C terminal of human SMC3. Synthetic peptide located within the following region: GKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: structural maintenance of chromosomes 3
• Database Link:
  NP_005436
  Entrez Gene 9126 Human
  UniProt ID Q9UQE7
• Background: This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein. [provided by RefSeq, Jul 2008]
• Synonyms: BAM; BMH; CDLS3; CSPG6; HCAP; SMC3L1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Oocyte meiosis