VARS2 Rabbit Polyclonal Antibody

CAT#: TA342462

Rabbit Polyclonal Anti-VARS2 Antibody

Product Images

WB Suggested Anti-VARS2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VARS2 antibody: synthetic peptide directed towards the middle region of human VARS2. Synthetic peptide located within the following region: LERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 118 kDa
• Gene Name: valyl-tRNA synthetase 2, mitochondrial
• Database Link:
  NP_065175
  Entrez Gene 57176 Human
  UniProt ID Q5ST30
• Background: The function of the protein remains unknown.
• Synonyms: COXPD20; VALRS; VARS2L; VARSL
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Pig: 86%; Rat: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Aminoacyl-tRNA biosynthesis, Valine, leucine and isoleucine biosynthesis