Cyclin Y (CCNY) Rabbit Polyclonal Antibody

CAT#: TA342535

Rabbit Polyclonal Anti-CCNY Antibody

Product Images

WB Suggested Anti-CCNY Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCNY antibody: synthetic peptide directed towards the middle region of human CCNY. Synthetic peptide located within the following region: DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: cyclin Y
• Database Link:
  NP_659449
  Entrez Gene 219771 Human
  UniProt ID Q8ND76
• Background: Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940) (Li et al., 2009 [PubMed 18060517]). [supplied by OMIM, May 2009]. Transcript Variant: This variant (5) lacks a portion of the 5' coding region, and initiates translation at an alternate start codon, compared to variant 1. The encoded isoform (5) has a distinct N-terminus and is shorter than isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK303283.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087, ERS025090 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: C10orf9; CBCP1; CCNX; CFP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 86%