UCH37 (UCHL5) Rabbit Polyclonal Antibody

CAT#: TA342561

Rabbit Polyclonal Anti-UCHL5 Antibody

Product Images

WB Suggested Anti-UCHL5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: UCHL5; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the C terminal of human UCHL5. Synthetic peptide located within the following region: KRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: ubiquitin C-terminal hydrolase L5
• Database Link:
  NP_057068
  Entrez Gene 51377 Human
  UniProt ID Q9Y5K5
• Background: UCHL5 is the deubiquitinating enzyme associated with the proteasome.
• Synonyms: CGI-70; INO80R; UCH-L5; UCH37
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Protease