PSMC6 Rabbit Polyclonal Antibody

CAT#: TA342589

Rabbit Polyclonal Anti-PSMC6 Antibody

Product Images

Lanes: 1: 10ug proteasome fraction from C57B1/6J mouse brain, 2: 10ug proteasome fraction from BLAB/C mouse brain; Primary Antibody Dilution: 1:500; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1:5000; Gene Name: PSMC6; Submitted by:

• 

  WB Suggested Anti-PSMC6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: PSMC6; Sample Tissue: Human MCF7; Antibody Dilution: 1.0 ug/ml PSMC6 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: PSMC6; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml PSMC6 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSMC6 antibody: synthetic peptide directed towards the C terminal of human PSMC6. Synthetic peptide located within the following region: GFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: proteasome 26S subunit, ATPase 6
• Database Link:
  NP_002797
  Entrez Gene 67089 MouseEntrez Gene 5706 Human
  UniProt ID P62333
• Background: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12.
• Synonyms: CADP44; HEL-S-73; p42; P44; SUG2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 86%

Reference Data

• Protein Pathways: Proteasome