VCP Rabbit Polyclonal Antibody

CAT#: TA342593

Rabbit Polyclonal Anti-VCP Antibody

Product Images

WB Suggested Anti-VCP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Liver

• 

  Lanes: 1. Mouse WT brain extract (80ug) 2. Rat brain extract (80ug); Primary Antibody Dilution: 2 ug/ml; Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience; Secondary Antibody Dilution: 1: 20,000; Gene Name: VCP; Submitted by: Dr. Yuz

• 

  Amount and Sample Type: 500 ug Human NT2 cell lysate; Amount of IP Antibody: 6 ug; Primary Antibody: VCP; Primary Antibody Dilution: 1:500; Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594; Secondary Antibody Dilution: 1:5000; Gene Name: VCP; Submitte

Specifications

Product Data

• Applications: IP, WB
• Recommended Dilution: WB, IP
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VCP antibody: synthetic peptide directed towards the C terminal of human VCP. Synthetic peptide located within the following region: EMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: valosin containing protein
• Database Link:
  NP_009057
  Entrez Gene 116643 RatEntrez Gene 269523 MouseEntrez Gene 7415 Human
  UniProt ID P55072
• Background: The protein encoded by this gene is a member of a family that includes putative ATP-binding proteins involved in vesicle transport and fusion, 26S proteasome function, and assembly of peroxisomes. This protein, as a structural protein, is associated with clathrin, and heat-shock protein Hsc70, to form a complex. It has been implicated in a number of cellular events that are regulated during mitosis, including homotypic membrane fusion, spindle pole body function, and ubiquitin-dependent protein degradation.
• Synonyms: ALS14; CMT2Y; HEL-220; HEL-S-70; IBMPFD; IBMPFD1; p97; TERA
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%