UFM1 Rabbit Polyclonal Antibody

CAT#: TA342603

Rabbit Polyclonal Anti-UFM1 Antibody

Product Images

WB Suggested Anti-UFM1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UFM1 antibody: synthetic peptide directed towards the middle region of human UFM1. Synthetic peptide located within the following region: LSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 9 kDa
• Gene Name: ubiquitin-fold modifier 1
• Database Link:
  NP_057701
  Entrez Gene 51569 Human
  UniProt ID P61960
• Background: UFM1 is a ubiquitin-like protein that is conjugated to target proteins by E1-like activating enzyme UBA5 (UBE1DC1; MIM 610552) and E2-like conjugating enzyme UFC1 (MIM 610554) in a manner analogous to ubiquitylation (see UBE2M; MIM 603173) (Komatsu et al., 2004 [PubMed 15071506]).
• Synonyms: BM-002; C13orf20
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%