FBXL12 Rabbit Polyclonal Antibody
Other products for "FBXL12"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FBXL12 antibody: synthetic peptide directed towards the C terminal of human FBXL12. Synthetic peptide located within the following region: PTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 37 kDa |
Gene Name | F-box and leucine-rich repeat protein 12 |
Database Link | |
Background | Members of the F-box protein family, such as FBXL12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]). |
Synonyms | Fbl12 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.