Antibodies

Jump to Filters
View as table Download
FBXL12 Rabbit Polyclonal Antibody
TA308590

USD 415.00

In Stock

Rabbit Polyclonal antibody to FBXL12 (F-box and leucine-rich repeat protein 12)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 265 and 326 of FBXL12 (Uniprot ID#Q9NXK8)
FBXL12 Goat Polyclonal Antibody
TA311466

USD 375.00

5 Days

Goat Anti-FBXL12 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RACPKESMDWWM, from the C Terminus of the protein sequence according to NP_060173.1.
FBXL12 Rabbit Polyclonal Antibody
TA342606

USD 375.00

5 Days

Rabbit Polyclonal Anti-FBXL12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXL12 antibody: synthetic peptide directed towards the C terminal of human FBXL12. Synthetic peptide located within the following region: PTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKE
FBXL12 Rabbit Polyclonal Antibody
TA376148

USD 220.00

3 Weeks

FBXL12 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-326 of human FBXL12 (NP_060173.1).
Modifications Unmodified