Sts1 (UBASH3B) Rabbit Polyclonal Antibody

CAT#: TA342610

Rabbit Polyclonal Anti-UBASH3B Antibody

Product Images

Host: Rabbit; Target Name: Ubash3b; Sample Tissue: Rat Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ubash3b antibody is: synthetic peptide directed towards the C-terminal region of Rat Ubash3b. Synthetic peptide located within the following region: AHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: ubiquitin associated and SH3 domain containing B
• Database Link:
  NP_116262
  Entrez Gene 315579 Rat
  UniProt ID Q8TF42
• Background: The function of this protein remains unknown.
• Synonyms: p70; STS-1; STS1; TULA-2; TULA2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS