MYRIP Rabbit Polyclonal Antibody

CAT#: TA342617

Rabbit Polyclonal Anti-MYRIP Antibody

Specifications

Product Data

• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYRIP antibody is: synthetic peptide directed towards the C-terminal region of Human MYRIP. Synthetic peptide located within the following region: QQRRKLPAPPVKAEKIETSSVTTIKTFNHNFILQGSSTNRTKERKGTTKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: myosin VIIA and Rab interacting protein
• Database Link:
  NP_056275
  Entrez Gene 25924 Human
  UniProt ID Q8NFW9
• Background: MYRIP is a rab effector protein involved in melanosome transport. It serves as link between melanosome-bound RAB27A and the motor proteins MYO5A and MYO7A. It may link RAB27A-containing vesicles to actin filaments, functions as a protein kinase A-anchoring protein (AKAP) and may act as a scaffolding protein that links PKA to components of the exocytosis machinery, thus facilitating exocytosis, including insulin release.
• Synonyms: SLAC2-C; SLAC2C
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Dog: 86%