Synaptotagmin V (SYT5) Rabbit Polyclonal Antibody

CAT#: TA342628

Rabbit Polyclonal Anti-SYT5 Antibody

Product Images

WB Suggested Anti-SYT5 Antibody Titration: 1 ug/ml; Positive Control: Fetal kidney lysate

• 

  Sample Type: complete mouse retina sections; Red: Primary; Blue: DAPI; Primary; Dilution: 1:200; Secondary Antibody: Goat anti-Rabbit AF568 IgG (H+L); Secondary; Dilution: 1:200; Image Submitted by: David Zenisek; Yale University

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SYT5 antibody: synthetic peptide directed towards the middle region of human SYT5. Synthetic peptide located within the following region: YLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: synaptotagmin 5
• Database Link:
  NP_003171
  Entrez Gene 53420 MouseEntrez Gene 6861 Human
  UniProt ID O00445
• Background: Synaptotagmins, such as SYT5, are a family of type III membrane proteins characterized by cytoplasmic repeats related to protein kinase C (see MIM 176960) regulatory (C2) domains, which are thought to bind calcium. Synaptotagmins may act both as negative regulators of vesicle fusion, allowing fusion in the presence of calcium, and as calcium receptors or sensor molecules (summary by Hudson and Birnbaum, 1995 [PubMed 7597049]).
• Synonyms: synaptotagmin 5; synaptotagmin V
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Guinea pig: 100%; Human: 93%; Bovine: 93%

Reference Data

• Protein Families: Secreted Protein, Transmembrane