Rabphilin 3A (RPH3A) Rabbit Polyclonal Antibody

CAT#: TA342633

Rabbit Polyclonal Anti-RPH3A Antibody

Product Images

WB Suggested Anti-Rph3a Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Mouse Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rph3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: rabphilin 3A
• Database Link:
  NP_001137326
  Entrez Gene 19894 Mouse
  UniProt ID Q9Y2J0
• Background: RPH3A is a protein transport. RPH3A is probably involved with Ras-related protein Rab-3A in synaptic vesicle traffic and/or synaptic vesicle fusion. RPH3A could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
• Synonyms: KIAA0985
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 85%; Horse: 85%; Human: 85%; Rabbit: 85%; Guinea pig: 85%; Dog: 83%