Rabphilin 3A (RPH3A) Rabbit Polyclonal Antibody

CAT#: TA342635

Rabbit Polyclonal Anti-RPH3A Antibody

Product Images

Host: Rabbit; Target Name: RPH3A; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RPH3A antibody is: synthetic peptide directed towards the C-terminal region of Human RPH3A. Synthetic peptide located within the following region: VWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: rabphilin 3A
• Database Link:
  NP_001137326
  Entrez Gene 22895 Human
  UniProt ID Q9Y2J0
• Background: The function of this protein remains unknown.
• Synonyms: KIAA0985
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Zebrafish: 93%; Guinea pig: 93%