SNAP29 Rabbit Polyclonal Antibody

CAT#: TA342640

Rabbit Polyclonal Anti-SNAP29 Antibody

Product Images

Host: Rabbit; Target Name: Snap29; Sample Tissue: Rat Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Snap29 antibody is: synthetic peptide directed towards the middle region of Rat Snap29. Synthetic peptide located within the following region: QPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: synaptosome associated protein 29kDa
• Database Link:
  NP_004773
  Entrez Gene 116500 Rat
  UniProt ID O95721
• Background: Snap29 binds with Snap25 to form complexin.
• Synonyms: CEDNIK; SNAP-29
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Zebrafish: 82%; Human: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: SNARE interactions in vesicular transport