CLRN1 Rabbit Polyclonal Antibody

CAT#: TA342660

Rabbit Polyclonal Anti-CLRN1 Antibody

Product Images

WB Suggested Anti-CLRN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLRN1 antibody: synthetic peptide directed towards the C terminal of human CLRN1. Synthetic peptide located within the following region: QSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: clarin 1
• Database Link:
  NP_777367
  Entrez Gene 7401 Human
  UniProt ID P58418
• Background: This gene encodes a protein that contains a cytosolic N-terminus, multiple helical transmembrane domains, and an endoplasmic reticulum membrane retention signal, TKGH, in the C-terminus. The encoded protein may be important in development and homeostasis of the inner ear and retina. Mutations within this gene have been associated with Usher syndrome type IIIa. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
• Synonyms: RP61; USH3; USH3A
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Rat: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane