ALDH3A1 Rabbit Polyclonal Antibody

CAT#: TA342721

Rabbit Polyclonal Anti-ALDH3A1 Antibody

Product Images

ALDH3A1 antibody validated by WB using Fetal Muscle cell lysate at 1 ug/ml.

• 

  WB Suggested Anti-ALDH3A1 Antibody; Positive Control: Lane 1: 30ug human primary hepatocytes; Primary Antibody Dilution: 1:1000; Secondary Antibody: Anti-rabbit-HRP; Secondry Antibody Dilution: 1:5000; Submitted by: Takeshi Saito, USC Keck School of Medici

• 

  Sample Type: Human Cornea; Dilution: 1:200

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the N terminal of human ALDH3A1. Synthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: aldehyde dehydrogenase 3 family member A1
• Database Link:
  NP_000682
  Entrez Gene 218 Human
  UniProt ID P30838
• Background: Aldehyde dehydrogenases oxidize various aldehydes to the corresponding acids. They are involved in the detoxification of alcohol-derived acetaldehyde and in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. The enzyme encoded by this gene forms a cytoplasmic homodimer that preferentially oxidizes aromatic and medium-chain (6 carbons or more) saturated and unsaturated aldehyde substrates. It is thought to promote resistance to UV and 4-hydroxy-2-nonenal-induced oxidative damage in the cornea. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Synonyms: ALDH3; ALDHIII
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Guinea pig: 100%; Bovine: 93%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Drug metabolism - cytochrome P450, Glycolysis / Gluconeogenesis, Histidine metabolism, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Phenylalanine metabolism, Tyrosine metabolism