NETO1 Rabbit Polyclonal Antibody

CAT#: TA342747

Rabbit Polyclonal Anti-NETO1 Antibody

Product Images

WB Suggested Anti-NETO1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 721_B cell lysate

• 

  Immunohistochemistry with mice retinal neurons tissue at an antibody concentration of researcher doesn't say using anti-NETO1 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NETO1 antibody: synthetic peptide directed towards the C terminal of human NETO1. Synthetic peptide located within the following region: MCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: neuropilin and tolloid like 1
• Database Link:
  NP_620416
  Entrez Gene 246317 MouseEntrez Gene 81832 Human
  UniProt ID Q8TDF5
• Background: This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in mice encodes a protein that plays a critical role in spatial learning and memory by regulating the function of synaptic N-methyl-D-aspartic acid receptor complexes in the hippocampus. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Synonyms: BCTL1; BTCL1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane