MRGX3 (MRGPRX3) Rabbit Polyclonal Antibody

CAT#: TA342779

Rabbit Polyclonal Anti-MRGPRX3 Antibody

Product Images

WB Suggested Anti-MRGPRX3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MRGPRX3 antibody: synthetic peptide directed towards the C terminal of human MRGPRX3. Synthetic peptide located within the following region: LDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: MAS related GPR family member X3
• Database Link:
  NP_473372
  Entrez Gene 117195 Human
  UniProt ID Q96LB0
• Background: This gene encodes a member of the mas-related/sensory neuron specific subfamily of G protein coupled receptors. The encoded protein may be involved in sensory neuron regulation and in the modulation of pain.
• Synonyms: GPCR; MRGX3; SNSR1; SNSR2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane