MRGX3 (MRGPRX3) Rabbit Polyclonal Antibody

CAT#: TA342780

Rabbit Polyclonal Anti-MRGPRX3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MRGPRX3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MRGPRX3 antibody: synthetic peptide directed towards the C terminal of human MRGPRX3. Synthetic peptide located within the following region: FLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPEVDEGGGWL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name MAS related GPR family member X3
Background This gene encodes a member of the mas-related/sensory neuron specific subfamily of G protein coupled receptors. The encoded protein may be involved in sensory neuron regulation and in the modulation of pain.
Synonyms GPCR; MRGX3; SNSR1; SNSR2
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome, GPCR, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.