Adenylosuccinate Lyase (ADSL) Rabbit Polyclonal Antibody

CAT#: TA342801

Rabbit Polyclonal Anti-ADSL Antibody

Product Images

WB Suggested Anti-ADSL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Muscle

• 

  Sample Type: 1. Hamster CHO K1 cells (20ug); 2. HeLa skin cells (100ug); 3. HEK273 cells (100ug); 4. HepG2 cells (100ug); 5. purified human ADSL protein (40ng); Primary Dilution: 1:2000; Secondary Antibody: Clean-Blot IP detection Reagent and Kit; Secondar

• 

  Host: Rabbit; Target Name: ADSL; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADSL antibody: synthetic peptide directed towards the middle region of human ADSL. Synthetic peptide located within the following region: RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: adenylosuccinate lyase
• Database Link:
  NP_000017
  Entrez Gene 158 Human
  UniProt ID P30566
• Background: Adenylsuccinate lyase is involved in both de novo synthesis of purines and formation of adenosine monophosphate from inosine monophosphate. It catalyzes two reactions in AMP biosynthesis: the removal of a fumarate from succinylaminoimidazole carboxamide (SAICA) ribotide to give aminoimidazole carboxamide ribotide (AICA) and removal of fumarate from adenylosuccinate to give AMP. Adenylosuccinase deficiency results in succinylpurinemic autism, psychomotor retardation, and , in some cases, growth retardation associated with muscle wasting and epilepsy. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: AMPS; ASASE; ASL
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Alanine, aspartate and glutamate metabolism, Metabolic pathways, Purine metabolism