APJ Receptor (APLNR) Rabbit Polyclonal Antibody

CAT#: TA342806

Rabbit Polyclonal Anti-APLNR Antibody

Product Images

WB Suggested Anti-APLNR Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-APLNR antibody: synthetic peptide directed towards the N terminal of human APLNR. Synthetic peptide located within the following region: NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: apelin receptor
• Database Link:
  NP_005152
  Entrez Gene 187 Human
  UniProt ID P35414
• Background: This gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified.
• Synonyms: AGTRL1; APJ; APJR; HG11
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction