Collagen IX (COL9A1) Rabbit Polyclonal Antibody

CAT#: TA342822

Rabbit Polyclonal Anti-COL9A1 Antibody

Product Images

WB Suggested Anti-COL9A1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COL9A1 antibody is: synthetic peptide directed towards the N-terminal region of Human COL9A1. Synthetic peptide located within the following region: GADGLTGPDGSPGSIGSKGQKGEPGVPGSRGFPGRGIPGPPGPPGTAGLP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: collagen type IX alpha 1
• Database Link:
  NP_511040
  Entrez Gene 1297 Human
  UniProt ID P20849
• Background: This gene encodes one of the three alpha chains of type IX collagen, which is a minor (5-20%) collagen component of hyaline cartilage. Type IX collagen is usually found in tissues containing type II collagen, a fibrillar collagen. Studies in knockout mice have shown that synthesis of the alpha 1 chain is essential for assembly of type IX collagen molecules, a heterotrimeric molecule, and that lack of type IX collagen is associated with early onset osteoarthritis. Mutations in this gene are associated with osteoarthritis in humans, with multiple epiphyseal dysplasia, 6, a form of chondrodysplasia, and with Stickler syndrome, a disease characterized by ophthalmic, orofacial, articular, and auditory defects. Two transcript variants that encode different isoforms have been identified for this gene.
• Synonyms: DJ149L1.1.2; EDM6; MED; STL4
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Horse: 86%; Rabbit: 86%; Zebrafish: 85%; Pig: 79%; Rat: 79%; Mouse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome