C1R Rabbit Polyclonal Antibody

CAT#: TA342834

Rabbit Polyclonal Anti-C1R Antibody

Product Images

Host: Rabbit; Target Name: C1R; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C1R antibody is: synthetic peptide directed towards the middle region of Human C1R. Synthetic peptide located within the following region: VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: complement C1r subcomponent
• Database Link:
  NP_001724
  Entrez Gene 715 Human
  UniProt ID P00736
• Background: The function of this protein remains unknown.
• Synonyms: complement component 1; r subcomponent
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Complement and coagulation cascades, Systemic lupus erythematosus