CD55 Rabbit Polyclonal Antibody

CAT#: TA342863

Rabbit Polyclonal Anti-CD55 Antibody

Product Images

WB Suggested Anti-CD55 Antibody; Titration: 1.0 ug/ml; Positive Control: COLO205 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CD55 antibody: synthetic peptide directed towards the middle region of human CD55. Synthetic peptide located within the following region: PGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: CD55 molecule (Cromer blood group)
• Database Link:
  NP_000565
  Entrez Gene 1604 Human
  UniProt ID P08174
• Background: This gene encodes a protein involved in the regulation of the complement cascade. The encoded glycoprotein is also known as the decay-accelerating factor (DAF); binding of DAF to complement proteins accelerates their decay, disrupting the cascade and preventing damage to host cells. Antigens present on the DAF glycoprotein constitute the Cromer blood group system (CROM). Two alternatively spliced transcripts encoding different proteins have been identified. The predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels.
• Synonyms: CR; CROM; DAF; TC
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 79%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Complement and coagulation cascades, Hematopoietic cell lineage, Viral myocarditis