BD2 (DEFB4A) Rabbit Polyclonal Antibody
Other products for "DEFB4A"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DEFB4A antibody: synthetic peptide directed towards the N terminal of human DEFB4A. Synthetic peptide located within the following region: LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 4 kDa |
Gene Name | defensin beta 4A |
Database Link | |
Background | Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. DEFB4A is locally regulated by inflammation. |
Synonyms | BD-2; DEFB-2; DEFB2; DEFB4; DEFB102; HBD-2; SAP1 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.