DOK4 Rabbit Polyclonal Antibody

CAT#: TA342886

Rabbit Polyclonal Anti-DOK4 Antibody

Product Images

WB Suggested Anti-DOK4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DOK4 antibody: synthetic peptide directed towards the C terminal of human DOK4. Synthetic peptide located within the following region: GSQNIAEASSYAGEGYGAAQASSETDLLNRFILLKPKPSQGDSSEAKTPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: docking protein 4
• Database Link:
  NP_060580
  Entrez Gene 55715 Human
  UniProt ID Q8TEW6
• Background: DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK4 functions in RET-mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway
• Synonyms: IRS-5; IRS5
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit

Reference Data

• Protein Families: Druggable Genome