MAPKAP Kinase 2 (MAPKAPK2) Rabbit Polyclonal Antibody

CAT#: TA342908

Rabbit Polyclonal Anti-MAPKAPK2 Antibody

Product Images

WB Suggested Anti-MAPKAPK2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAPKAPK2 antibody: synthetic peptide directed towards the middle region of human MAPKAPK2. Synthetic peptide located within the following region: KLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: mitogen-activated protein kinase-activated protein kinase 2
• Database Link:
  NP_004750
  Entrez Gene 17164 MouseEntrez Gene 9261 Human
  UniProt ID P49137
• Background: MAPKAPK2 is a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo.
• Synonyms: MAPKAP-K2; MK-2; MK2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: MAPK signaling pathway, Neurotrophin signaling pathway, VEGF signaling pathway