STYXL1 Rabbit Polyclonal Antibody

CAT#: TA342934

Rabbit Polyclonal Anti-STYXL1 Antibody

Product Images

WB Suggested Anti-STYXL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STYXL1 antibody: synthetic peptide directed towards the middle region of human STYXL1. Synthetic peptide located within the following region: FLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: serine/threonine/tyrosine interacting-like 1
• Database Link:
  NP_057170
  Entrez Gene 51657 Human
  UniProt ID Q9Y6J8
• Background: STYXL1 is a probable pseudophosphatase. It contains a Ser residue instead of a conserved Cys residue in the dsPTPase catalytic loop which probably renders it catalytically inactive as a phosphatase. The binding pocket may be however sufficiently preserved to bind phosphorylated substrates, and maybe protect them from phosphatases.
• Synonyms: DUSP24; MK-STYX; MKSTYX
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 86%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome, Phosphatase