Heparanase 1 (HPSE) Rabbit Polyclonal Antibody

CAT#: TA343051

Rabbit Polyclonal Anti-HPSE Antibody

Product Images

WB Suggested Anti-HPSE Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HPSE antibody: synthetic peptide directed towards the N terminal of human HPSE. Synthetic peptide located within the following region: KLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: heparanase
• Database Link:
  NP_006656
  Entrez Gene 10855 Human
  UniProt ID Q9Y251
• Background: Heparan sulfate proteoglycans (HSPGs) are major components of the basement membrane and extracellular matrix. Heparanases, like HSPE, are endoglycosidases that cleave the heparan sulfate side chain of HSPGs to permit the remodeling of the extracellular matrix for cell movement or the release of bioactive molecules from the extracellular matrix or cell surface.
• Synonyms: HPA; HPA1; HPR1; HPSE1; HSE1
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 92%; Rabbit: 79%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: Glycosaminoglycan degradation, Metabolic pathways